PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G66990.1
Common NameK8A10.6, RKD3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Nin-like
Protein Properties Length: 277aa    MW: 32393 Da    PI: 8.9971
Description RWP-RK domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G66990.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.11.3e-26157206352
       RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  +++s e++++yF++pi++AAkeL++++T+LK++CR++GI+RWPhRk++sl
  AT5G66990.1 157 NNMSREMMKQYFYMPITKAAKELNIGVTLLKKRCRELGIPRWPHRKLTSL 206
                  6899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.303142226IPR003035RWP-RK domain
PfamPF020424.5E-22158206IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MADQRPLMTW LEANNYESFL QEDIFSFLDQ SLFVDPHSSF IDPFKDFQTQ NWFSLQDSIV  60
NHISTTFAAD HTFLASLDLE AISSTFSLDI SSGWWNENNG NYNNQVEPNL DEISRTNTMG  120
DPNMEQILHE DVNTMKEKTS QKRIIMKRRY REDGVINNMS REMMKQYFYM PITKAAKELN  180
IGVTLLKKRC RELGIPRWPH RKLTSLNALI ANLKDLLGNT KGRTPKSKLR NALELLEMEK  240
KMIEEVPDLE FGDKTKRLRQ ACFKAKYKRR RLFSSSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267271KRRRL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184251390.0
Expression AtlasAT5G66990-
AtGenExpressAT5G66990-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G66990.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G66990
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266400.0AB026640.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K8A10.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_201500.10.0RWP-RK domain-containing protein
SwissprotQ9FGD10.0RKD3_ARATH; Protein RKD3
TrEMBLD7KT000.0D7KT00_ARALL; Putative uncharacterized protein
STRINGAT5G66990.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121801932
Representative plantOGRP5671777
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  3. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]
  4. Koszegi D, et al.
    Members of the RKD transcription factor family induce an egg cell-like gene expression program.
    Plant J., 2011. 67(2): p. 280-91
    [PMID:21457369]